TCDB is operated by the Saier Lab Bioinformatics Group
>tr|J7YEJ0|J7YEJ0_BACCE Uncharacterized protein OS=Bacillus cereus BAG3X2-1 GN=IE3_02469 PE=4 SV=1
MNGLIFTAMISFGLPLVALLYAFWKKRYIPYMLGVLAFVVSQILIRIPILNYVNGTSTNFQMFSVMQPVLFVLLLSLSAG
IFEEIARFIAMRYCMKQRDWQSGFLFGAGHGGIEAVLIVGIPVISLLLSQTVIQNGDSYYFGGIERIFAMVLHVGLSFIV
LQAVVQKKFRYVVYAILIHGIANALAGIISLYVPGASGIIMSEVSIAICALLVFSYSFILKRKGVLK