TCDB is operated by the Saier Lab Bioinformatics Group
>tr|J9ESM1|J9ESM1_9SPIT Uncharacterized protein OS=Oxytricha trifallax GN=OXYTRI_10260 PE=4 SV=1
MSLINLHTRIVDKFKLAQFRVDKINRQIEEFCQKIIKDIQNSDELKCLLKQRDLQGNDSLYYMSLHNVYSILDTKSTDRI
IQDFWKSNIDVNGNLFSASTSYRLLEEIIQGNHIDFKKFNFKLLSKNHESLLKSHNYQYQVWKKSMQVRYFFESVMFLGI
AVFFQIYINEFNTLLHTVSSSMDAMDNDPTLSYEQRLEIATEWRDHLETAGLSITTAMYVSCMMFSFPVRQIQTKLFSMF
LKRKYNMFKASSIVEIGFSICIIVWISKFVSADQPTGEPGEFDKNFNKLQVFVHNAVEEVSENIFKFDILLAVHTSFLWM
KVMLLLKLTRSFGPLLKIIEHMVHDFIYFCIIWGINLIFFTFLGMLLFSEIELFKSFQNTLIMLIQSSLGQWDLTMYDDL
SFGEIFGKIYHLVFLIVNLVMLLNLMIAILSTTFTNMHQLKLALYYDEIIEAIPQYKYDKVYGSLICSIPPFNILMLPTS
IIYFFIKDKDKLARINSFLVKIAFAPKILLITPIFIAGNALFLPFAYLATVSYLFKQLFSKRKQSFIQNLGIFLAFTIFG
LLLLFTTLLSDIVIFLKHLFSRRNEKLSQFLKPQISKNAIRITFDIVQQQVFKKVTTMNSNQVIKLVRDAMHIDQTIIGL
IYGDSKQLNDKVTNKEIFDNQSKEEYLLSLKVFNTVKNVIRNCTNDNNITDIKMLLCLLKEVSCKMKVANLNHPFINLDK
NDQFLNNQISQDLTNPLNSQRIFDKDNSSNQSIFQRFGKQNQVPIQPTNRKDGAKRKNHNDYRKFKKNLFLEFSFVNPNR
TIDSVKDQQQDIALQNQKLLIKLTSLTEKILGNQRPNSEEKYHSQLSKSSTKDSRLSSPNKRKLLNKNKTQKSTFNRLWE
SSNNVMTTFKDKEINIKSLDDNQIDQFNEIKEEENDKLESPQNQLQSYSQLMSINQTQKVVKEENFQKVIDSLFQNQEDI
NF