TCDB is operated by the Saier Lab Bioinformatics Group
>tr|J9HU04|J9HU04_9SPIT Transmembrane channel-like protein 8 OS=Oxytricha trifallax GN=OXYTRI_09529 PE=4 SV=1
MNYYNRRGVGGNQKPYENTLNSIDQLDRLANLDVKNLKIEDLLDDKKLNQILGGGNQQPQNQNYNPFLDYNNSNQLGPSA
PLSQRNRDNNNVQSLQKGPSYLKQNLVNDYESQKPLLYQRKEQTYEQKKLNTANLQQNEGILQPQVMPRQSRKQDGDEFN
TQQNSLQQSKYNSKPVKFEGVPDALNLKSNDRTPINNNPSQNQPEVVQMQLPAFDENGMQKPVFFLGADFDEHDPNFDPN
VQEDLIDEETLKKIEEFKQKFLNMKKKAEEAEQDLAYSSIKVEELVSKIKDLEGKKNEFKDELVNETRQGAALRRKLADL
EDDKISLEQQLESGFKPNKFTKLKEVNLAKHKQLMEEKARREREEMKRQVLIGIDLQDKKMTQKFLLLLKKSNYDKSIEG
FFLFFKFLVNISFFVLALFMIIILRHVFNYKYDFTSFCSTGIFKMPCFTFYSRFHTDDEFYYSLTLELFIIIGIFMSLYK
WVQFDLLKKERSLYEDQKKKFSKIFFNMWDWSTNNSYESYQLKNALRMEIKLNIDEDKIKETIKQRKSLEKTKLFIRRIL
TFILNTLILLCGWGLILLVNIYQSDIQNYFESFSILKYVSTFVATLCLSIINVAVPHLIKSITQLEAWDFQDQLIKQQVW
RMYLAKIMNFAIFVFIELELILGKRWFNNITLVTFNENGQNFDCKEDQVAIQIFKLLITELAIKLVIPFLKALGERFFFG
LMKGRKQWQPEYLLSDDIVWLLYFQAIVWVTLILYPFITVVIPMILFVLFKHHYFVLRNFKSKPKKSSNANDTGFFIMIF
LNITFFSVSALILLFMSQSLDHETWLTNSQINCGPYPDLHSGQYSIEEQIQRSEAASYIYYIEYQLQIEELQKSITKLQR
KIDYNKMAQL