TCDB is operated by the Saier Lab Bioinformatics Group
>tr|J9IGQ1|J9IGQ1_9SPIT Uncharacterized protein OS=Oxytricha trifallax GN=OXYTRI_00458 PE=4 SV=1
MIPQGGGFGSNDNSRVGNQQPSSFVNNMDLTLNNVLYNNGDYHNNNNLSIAQPITDRLTHNLDLQRQYSAQKLDRKLQSQ
NIKSSQLRTGTAAKIHPLNMKPTAQFNNNYDNPYVGSSGSGNMQNNDYFSFNNRNDNTNLSQSKSALNNTSSIVVPSNQM
YRYQNQTETTRDLTRVNLDKIGKDNLIKLAQLRKQYDQCQDVILDYQRKMAENQVKVDKSLETYNQINQQKEVYKQKLYE
VKKENLKIVRKTENVTEEIKELDEAFKSGLEVAKRGVGGYGGYGLQRQNKFGTIDEATRQEREKMKKNLYVGVDYIGDED
IRLNADVKHKSNWDRFQEKLWMLIEKFGPLRGDIRYIEARYDKQILNFFVFFRFIFYLSLVTFATFLYLCIKHIELYISK
SSNVRQLCDEFYPFYARALFNCWDWRISDSRGVLNQRIQVYNQIKLRQREDRIRIELGMRSEKEKWRLIIKRSITMIFSF
IVLTIGWMIIIILSIYENDMQDYISKYNKFLGTWAPTALVTLVNFIVPKILGMITDFEEWEFASTQMKHEVWRTYLAGIL
NNLIFVVIYTEVFIDKPFLRDTFIADFYQSNSNGVIRFPCKEDMIAIQYIKLLISETVIRYLYYLYWIVHHKVVSYCKGV
SWKKPFETADILWFNMIFSPFISLLSPILLYLHFRFIYLRLTKMKVQPEGASNDDKIGYFIMVFMNITFLCVVVFVGFLL
FYPAPHSFNLVRTYEYCGAFSSESYWYEPIENFLIEGEAGDIIFTYFISNSILLLFFSIVFIVLTSVFWKNIKLLLSYIE
SKTKEVEYNIDDLQYKLRGLQQKDKYFRDNRKIE