TCDB is operated by the Saier Lab Bioinformatics Group
>tr|J9VT71|J9VT71_CRYNH Uncharacterized protein OS=Cryptococcus neoformans var. grubii serotype A (strain H99 / ATCC 208821 / CBS 10515 / FGSC 9487) GN=CNAG_03394 PE=4 SV=1
MTDSKISPFFSPKLLLARLSRLTSTIPGLDASLMLAQYSSPIVIALLLKLAAFKARHPKVTFASGAGKRTLTVDGGFGLA
KIAEGWGKAAGSIGDARVVMRAFGLLPIIQWILSLHPRPLAALKSLLISGDFMQVLGSQKTLPTLQALAILFYYPLEHVS
WLGSKGVLPISPLALSKAAIWSVRFWAAYIVLEIYKLRNSYRELSDRTRAFQLSRPEVTLSETTDYEFQDDKKDGFSEKP
GRSAEHDGEVTPRQELADDWKTWKRRALVNGAYAPLTIHWSTPGGLWSNPLITGTLGSFAAIGSLLSEWNKSDIQ