TCDB is operated by the Saier Lab Bioinformatics Group
>tr|K1L960|K1L960_9BACT ABC-type transport system involved in multi-copper enzyme maturation, permease component OS=Cecembia lonarensis LW9 GN=B879_00242 PE=4 SV=1
MFVFLKKELKTWIKSPMLWIFFLIIGLLVFGAVSSDDIQIGGASTSVKKNAPSVIQQYYGIMSLIALLMTTAFMNATANR
DFESGFSGILFSYPIKRSSYFFGKFLGAYLIALIPLLGISVGALVGPLMPWADPNRFGPVYWEGHIQGFLSFGIPNTFII
GVLTFALAVTFRNNMVSYIGAMGLLVLYAIAGNFIADIEKEWLANLLDPFGFYPVGLANKYATVEELNTTAVFLKGDLLI
NRLVWVGVAAAFLLLLYTRFSFQQKNEKVKKEKKVTKELSESSAVLERPAVTIDSGNKFSFAVFGRLVWFELKAIVKNQT
FLIILIIGIINLITGLTFFTGRYGSSNYPLTYDVIDSISGAFYLFLIGIIIFYSGVLVWRDRDAHLDEIKDATPAATGFF
LSSKILALLISVQLILMTTIVIGIIAQSFYGYFNFELGVYARSLLVNDFLFFTYLTVLAVFFHYLINNRYIAYFVFVVFI
IASDYVLELLKIESLMVSYGAVSRGSYSDVNGFGPWATATAWFQAYWGAFALLLVYVAYLFFMRGKTTALAGRWKDAQER
FVGSKAVFFVFIAAFLAIGAHVYYNTQVLNTYKTSKEWEDIRVAYEETYKVHENIPQPKWVSMDYRIELYPEDRDLTFEV
VGVMENRTDGPISELHFTMTDSKDKLEISIEGASIQLDDDQLGYRIYELARPLQPGEQLTMKVSGEKRTQGFENRVTNTS
ILKNGSFFYSYEMVPSFGYQASNELSDRNKRRKRGLPEKKRMPVLDENNLEARNFHYIGKDSDWITVKSVIGTSPNQIAV
SPGKLVREWEENGRKYFQYEQEAPSVHFTSFLSAAYQVERERWKDVAIEVYYVPGHEYNIPNFISAMSQSLDYYTAHFGP
YDHSQLRIVEFPRYAGFAQSFPGTMPYSERIGFITDLRKVTEDDIDLVFYVTAHETAHQYWAHQVIAANMRGAELLMEAI
TQYSALMVMEKEYGRDKMRKFLRYEMDGYLRGRGSEFVAERPLVETEQQGYIHYEKGSVAMYYLKEMIGEAQVNAALRQL
IEEFKHQKPPYPTSMDAVRVFRAHTPDSLQYVIDDLFLNITLFSNRVLDANYTQEGEEYIVEFTTESKKFRSDSLGKETA
IPIADFIDVGVFGFTENKNLLGDPLVYERLKVTQEGNTFKFRTKEKPHFVGIDPYNYLIDRVPGDNVKKVSLLD