TCDB is operated by the Saier Lab Bioinformatics Group
>tr|K2NRY3|K2NRY3_TRYCR Uncharacterized protein OS=Trypanosoma cruzi marinkellei GN=MOQ_004408 PE=4 SV=1
MNPAVPHSYLSTAWRRDRVPAVLQFCSMVVSGVAGSVGHRSIERSAKSLARLLSEYGSVTRMCNWLVVLLELSPAGVRRT
MRTSPGFFTGIARIVTTMFLGLFLASEEVELLAAGGVLSKVWRPYAARLVPIFFFYYNLLKAATSAALLQAMQRISFEAT
DTQSVIRKRHYKELFLSFMEGIAFMVYAMTLLPSNAPRLREALNEGLWMDRVYSVFSSLCPQVVQVRPATQGLLGLLATA
PFLFLSF