TCDB is operated by the Saier Lab Bioinformatics Group
>tr|K4E1F0|K4E1F0_TRYCR Uncharacterized protein OS=Trypanosoma cruzi GN=TCSYLVIO_004502 PE=4 SV=1
MIPVSVKKLEESVHVKHRIRNAFSLWWLGMINNFHYTLVLAGSDGIAEGYGMKKYVALITFANVFFGIISNFLNAFVIQR
LSYNIRVTAASLMTTMAILLVSFAWGIGGHNNVAAFIVMLIGVTFVGVSSNYGSSVFLGYMERMPSWQISSWSSGTGLSG
VSASLIFLGLSSAGMTSSQIFLTSTVFVVVYWAMYFFGLKLPYCVPVKFSSTTMRSNSRSEVLRGEEEEVEYVCKAMVNW
KGTPWTNIVPAKPEFKPECLREMERARRASDFADGEHEDVANECEACGDAHLSGWARWKRDVWPLIKVMHRATLCNNFNL
ALVYVAEYAVQFMTPFSFPRQVKESTNFWLKNSFVITQFCYQFGVLISRSSLLCVRIRYVWIMSVIQVINAIAWFLQAKV
KYMSDPNNMDRELKFAFVLFAWMIFVGLMGGASYVNVFHNILEETRLMQEKELNEAMVFLASRQRNGGDAGGAHAERGEQ
ERNVVDGESKEFCEAAHYITTVWKEKRDLAMNIGSIYSTIGITLGSLLDLLFTLVVLKGEAEA