TCDB is operated by the Saier Lab Bioinformatics Group
>tr|K6BIH6|K6BIH6_PSEVI Heme exporter protein B OS=Pseudomonas viridiflava UASWS0038 GN=AAI_25842 PE=3 SV=1
MSNVFILLLQREALLLARRPAELANPLVFFAIVIALFPLAVGPETQLLQTLSPGLVWVAALLAVLLSLDGLFRSDFEDGS
LEQWVLSPHPLALLVLVKVLAHWVFSGLALVLVAPVLALMLGLPGHCVPVLMLSLLLGTPVLSLLGAVGAALTVGLKRGG
LLLALLILPLYIPVLILGSGALQAALQGMPATGHLLWLGSLTALAVTLTPFAIAAGLKISVGE