TCDB is operated by the Saier Lab Bioinformatics Group
>tr|K6BJ24|K6BJ24_PSEVI Cytochrome c biogenesis protein CcmA OS=Pseudomonas viridiflava UASWS0038 GN=AAI_25837 PE=3 SV=1
MTAVTPLLHATALTCERDGRLLFENLDLALKAGDLLQVSGPNGSGKTSLLRMLCGLMQPTEGQVMFNGHALGRQRPQLTG
LLVWIGHASGLKELLTPLENLSWLYALQGNGEPADFEQALETVGLSGFEDVPCHALSAGQQRRVALARLYLPGPPIWILD
EPFTALDQQGISQLEACLTEHCARGGVVVLTTHHVLGLKPAGYRQLDLGNRPA