TCDB is operated by the Saier Lab Bioinformatics Group
>tr|K6YJU3|K6YJU3_9ALTE Uncharacterized protein OS=Paraglaciecola polaris LMG 21857 GN=GPLA_2074 PE=4 SV=1
MNVFSFIRNLFENAIKLVDGLCTTDEERLLQSQTAIITAESTGQSWIQRNWRPITMLTFLAFFVMDSFAWLPTPLAKEAW
ILLQIGLGSYVAGLSAEKITRQHLQARPADDKGTQTAKG