TCDB is operated by the Saier Lab Bioinformatics Group
>tr|K7ZLU1|K7ZLU1_BOMMO Scavenger receptor class B member 1 like protein 15 OS=Bombyx mori GN=SCRB15 PE=4 SV=1
MSSIFKVSPPQEGIKRRLLLALSLGAFLLISSIALILTDPMWAIAKYKFRLANGSILHELLSSEMEGGRFAVYLFNITNP
DRFLSGEDPYLKLDEVGPFTYLEYRTHSELQFDREAGVMRYTPRMRSVFVPEESIGNPEDIFLTMPNIPMLSATTMIRSS
PVFIRNIYNIVARQYGSQPIVKLAASKYLWGYKDPVLTFANSLVPGLIYFNTTGIMDRLYDKNVHYRMELGTNDDDKFKI
KRIHKYTRLHPESEVFDESILTFNDTYEGMAYPPMIGKNTPINIFRLGICKSFEMEYHGNKTSEYGPNAFVYKFNEKMFE
NNLCDVKGACPKGVMDLSACFYGLPMGLSKGHLLDADPKLFDRIKGLKPDPEKHSSHLVIEPKIGLTLETSWSLQANIFV
GDITYNAEAKMFSNMILPIAHFKIKQPHLPSIAITALRMMYITVPKALFITEILLMLSCLLLLVYSAWLLHWKRVHKKQP
LSEKELQISSRMANEPLMSYLTIN