TCDB is operated by the Saier Lab Bioinformatics Group
>tr|K8DWI0|K8DWI0_AERHY Mature outer membrane protein C (Fragment) OS=Aeromonas hydrophila GN=ompC PE=4 SV=1
TVYNQNDTKLDIGGRAQGMYYGTDDNGSEGDASYLRLHVAGETKIAPEMQAFGFAEYNLPTSGSDNDELRYAYAGIKHDR
FGAFSYCRQDGLFTKAVNNYTDVLPEWGGDGLGKNTEVFGTGRTNGLAQYIYTYQGLTLGAQFTGNNDPQNADRSNLTGA
NNATWNPKGSAEGFAVSANYDFDMGLSLGAAYNQAGKTDEQAANASFGGDSDAKLYGVGAKYAVGDLYLAATYSHGEDHM
YVSTFNGYAEKMDGYEAVAQYAFGKFKPSVAYLRTDVKDNARGIDDTATEYVSIGAWYNFTDNFNAYVDYKINLLDNVNG
THTNSLGKNTDDVVAVALQYNF