TCDB is operated by the Saier Lab Bioinformatics Group
>tr|K9HYV0|K9HYV0_AGABB Uncharacterized protein OS=Agaricus bisporus var. bisporus (strain H97 / ATCC MYA-4626 / FGSC 10389) GN=AGABI2DRAFT_147596 PE=4 SV=1
MIPPSPSTQFLATHSATILAPAAPTGTVSNGNGSLLDQNFHTVCPGNGLDAASAGVIAALLIFAALRPRFRQVYGPREWF
VPPESRPKPLGSGFFAFLNPPVPIVPDVSQDVHDAGRSASRDAQLFPSDEQLSQRTLLLALFIAIGWSILALGGALPMYL
VNTPCHTQLPTHTTFGGDYSSLQDLSLVRLLRLFDEKHIQTTTLDSLSRRALIGDPNDPANTRLRIIILTAITLVLALLP
ALWAILQQFNIILDYRKRWLQIKCEGKDLGWLSSKSAPGFQAWGEKRFKSFIKNIGLTSGMDEDEREARRSRRNDGKHTR
RKPKRREEEAPLYGSEKDNEVDIQCLFSISDTQHIALLIDQRDEILENLEIAEAHYINSFQVTTPDPSVLDFEPHPPPPL
DPSRPYISRPLPLGQGAPPRTKKRRAINRAYGTTSLAPTSFVAHSSFYRLRGVNGLSGGRLRGSNTPSFTESISSRIVGS
RFLEINRNSATYGRLTLGNRISVDRHGQLGPSGDQEAGSRTSWIPDPRLYGPNWGAEPFNGEGISEHPGPEYIDEHGVKR
SAIRSNSETIRVLGENTATSPGGEWWSEAGGPIESETMYNGFSHEEDWVDLEKENGPGKDFNSDFNGLPPSAGPSKFRRR
PPVPEAEAVSSSRRETFPLRRRDQELPPVPPPHLRLQQSQPFVRPLDGLNFEDLGHVYEDITHWRSQLKSINSQILDAQK
QSYDDIAEGKNIRGWLIVGRGLRHLPGVEVIEGRAKEDIRWDVLQNERTLLDRMVFWTIVCIVAVLLAVGLTAAAGLAVS
PAPDVVRSLPFLEPLLSTGTLASGIATVLLPAVAATLFIVLAVYLIHLVANIHGSISRSSSQLFIFKTIFYFLVITATMF
LTAAGGLLFALQAFVDGSRHARSIASGSIYITVLILAIVILFAVIVPGLLLLQPIRLWNVLRAEQLAVTPRQRFRAVYPR
TYDPTFALSSCILALMFASTFSLIFPIITPAVVLLLLLNLVAHRYLIGYVYARMHSQTGGLLQLWLLKRFATLCSFQPIL
LGSIFLSRRIWIEGGISIGTGVAVMIFVEIYATLKLRLPGRGSLRAITRDSLDHFARAAERHLEDSREEMTSENDTRGHF
TRGSMASVLDMMSLTLAVKPSAPTYRGPVPLPTETLDDLIATERAARTHPDTPPHLPPHLPPLPFSDHADDMAGILYAPE
LIAPCPIIWLPRDSADVAESEAADLKRYHALECTLDVKSKDSLMRQRSSSSRGRRAPR