TCDB is operated by the Saier Lab Bioinformatics Group
>tr|K9ZHC0|K9ZHC0_ANACC Ferric reductase domain protein transmembrane component domain protein OS=Anabaena cylindrica (strain ATCC 27899 / PCC 7122) GN=Anacy_2279 PE=4 SV=1
MLDLLLITILGFLGSFGHCFGMCGPLAVAFSLSHQEETQGWQQQLKFHTLLNLGRMLSYALVGAGIGALGSVLVEGGQLV
GIGSDFRRWIAIITGVMLIWFGLGQVKPDLLPSIPLLHPLLKGSLHNRLSAGMVKLSLHTKWWTPALLGMTWGLMPCGFL
YAAQIKAAATGNLWHGAITMLAFGLGTLPTMLGVGVSTSLMSKDRRSQLFRLGGWVTLIIGAITLLRTGDTMVDYSGHAA
LICLILALIARPISNLWTSPMRYRRALGVGAFVLSGVHTIHMIEHSLEWNFAAFWFLPPEFQWGMGAGAVALVLMMPAAC
TSFDFLQKSLGKHWRQIHLLSVPALLLSAIHAVLIGSHYLGALRLTWENKLAALLLGIITLCVLLVRSHYFWSKSSIEKL
YVPPKNIGDR