TCDB is operated by the Saier Lab Bioinformatics Group
>KAA3612492.1 hypothetical protein DWQ03_14200 [Calditrichaeota bacterium]
MISFYQSIKINAIYEIKILLRGWFFRIFAIGSIVSLAGMNVLFHSSVSPVPRFIHSMDSFLPYMSIAMPHYLLIVVLIFL
TTDLYKRDKKFNTSDVVYIRDMSNLSFLLGRISGILMLFFALDFIYILSGAIVNLFFSNLSFIWQVYFIYPLLLSMPALI
FAVGLTMFLMHVVRNQAVVIILVIGLLVASVFYGSDFGFLMFDILAAKLAFTYSDFTGLSNFTTLASQRLGWFGLGLVFM
LLSVLLVQRLPQSKKAKVFIIISLIGMPLVSGSFFFNYYNYYKEGEQLREKVARQTELFLTNETVHVNSYDLNVKHEGNR
LFVEAKLGFENRSNHPIDTVKFLLNPGLQISRVSQAGRDLTFSQNGIVAKILLDEKLIQTKSGSLQITYSGSIDDRIAYP
HIIGEDRDQTHYIWMYRMEARYGFTEDNYLLLPPALYWYPKTYTAGHRDILKPFSAFSLTVQTSKDLIAISQGNVINNEP
GIFEFENTISLKEISLIIGPYDKKTIQVDSLEISVYSYEQHDYYKEFFKEIGDTLPEVVKSQLQDFENKVGLSYPFDRFT
IVEVPIHHHAYQRNGRLNADFLQAEQVWLPENMATLSSSYFKHQQERQKRFGNRSNQTYTDLEKEIMLFRRFVNNTFIGM
EGRRFGDENLMSFVPDLNVYPLFLNFCLALGDEENQAFAIALESNLRQDAIFQGPRNRWSIGELTTTEEANLALSDTSLD
VIMKAADEDLVNKVLAVKGSYLLKKLKHILGESGFDNFMQNMIAENRFKSISVDSIAGILKSDHNYDMTSELKQWRYDDR
LPGYLIRGFELYQIRDGDRLRYQVLFSVYNPTPVSGLIEVEFSYPGEGRRRFMEGITANSEQWLYEIEAEKSLQIGIVLD
AEPRAIRVNTLVSQNLPTVYSHVFDDAELKQNTKAIEGQLLFSWMDEVEKDDAISDNSGEDFGYVHPQYHSQLKEWIHED
ANKEKDEYEGFAWWYGPSQWKKLKFPSFYGEFVHSAYYARSGSGERKATWVADIPEDAFYQVYVHVPDKSDFRRGRRGGE
SFGVQKYIIYHSDGEDEIELDFSEAEPGWNYMETYYFKEGQGKVVLTDDSDGRMVVADAVKWELKE