TCDB is operated by the Saier Lab Bioinformatics Group
>KAE8599942.1 hypothetical protein XENTR_v10017404 [Xenopus tropicalis]
MSEEREAPGPMASSSAGLGVEVGQEEAPGGAGPARLLLLPSDTDGPPKKRLRAETEPGSVRLEERLLSVHVAVPSCLDLA
KASVYQCTNGHLMCAGCFIHLLADARLKEEQATCPNCRCEISKSLCCRNLAVEKAVSELPSECGFCLKQFPRSLLERHKK
DECQDRVTQCKYKRIGCPWQGPFHELTVHESECCHPTKTGNELMEILDEMDQTHKKEMQLYNSIFSLLSFEKIGYTGTSK
DLIISLRKSVHQKSLLTLWVVKPSCPIWLY