TCDB is operated by the Saier Lab Bioinformatics Group
>KAF0724324.1 hypothetical protein Ae201684_016986 [Aphanomyces euteiches]
MCSVGAAPAIRDVLREEDDAPVPKRMRLNTTTRWDAKPGDGSSLLSSMQQRMHDVRDAYATAQRPFRCPICLDTLGDIVV
ECAECAHVFCDPCLRESLKRNEKCPLCRCKPTPLRRNKPIERLVAALPETCPFLENGCWASLTRATASHHALTCGFARFT
CPHCHLVFLRNAHDETLCSALVVACPLTHLGCSFRARLVDMDDHLKERVHFDLAMRLLQDESPPASSSPSSTSSPSSELS
KQALNALLEMATTAWNEKDEATNLARVEFVQAMETRAPLPP