TCDB is operated by the Saier Lab Bioinformatics Group
>KAF2072454.1 hypothetical protein CYY_006230 [Polysphondylium violaceum]
MSKNYDDHKSHLLGDNHDGFGEFDSSFNNTFQSNSNSPQFNNGSSKYQKLRDEDMDDNDDSSPSTYSNPHTDSPFLKSNG
LGGKTSSLSSFETFSLGHGHKIDREKDDGSSSFNMSTVKGFFQYLYVSLRYTLYGDLRVALKYVHNNSKRNKKSLLLGLF
TIFLVVLFISFLQNLIQASPIVFLKLSEDQTGELDLVITGDPNNYGSANTSLLLATPVYETSSEEAQYNKVDTREKLAEA
MDENDFNGVSTDQQISRATSLLDVVKDTVASVNNQLNFIGDLSGYFVNSTFLNQTLYGASTVHGVAPRWLSIGNIKNANT
DISASLILMVMNTNLEKSLNLGRGWTHPALVGNQIHITKSFLTRIGVEPNKGESVHLHMSFVDVLERLGTQALPTVKDIT
NVIEQYTQQPIPDSFNITALVDIYQSIYPSKNMTQVLTDMFDNGINITKIDATTYSYIIFPKIIISNYYSFFENDLTIDK
ELVVVDAIKSSGGKFPNSIGNVGVLESSFVEQLIVEKLDNISQQLNSSVFQNIVQLAEFVESIYPNNNYSMIIDQVINLQ
DRITNFTRQFKIDYYSMSSVVMLQNRVKIYTASDQEMMNGFMAFTNQIASRLGYSYPVTFTTPLSTTVQMFMYTKLSLNQ
IFNCVATVLLVLGALMIYSLLLSDVEGKTFEYGMLRAQGMRHYALILLLLSQALYFSIPGIIFGLFFGWCVYSVVAYFVY
CKFVLLPIDLTFYSTSIISGLFMGLLMPIVANIAPIQRALSRTLRDALDVYHQVKNETIVKIMKLEEIGLDVLQTLLAVM
AVGVGFTVYYLIPLSFTFRNYGLFFGILTGILMGMLFGMSMLAQAIQPFVEKAVIFCLILGKDRKSLYNLVRKNLFSHSS
RNSKTATMLTISLTFVIFTGCVFRLQGHNIQELVRLGIGSDVAVVATSTFNPIPEDKIRAFLDNDIANNTQSIVTSYSTV
TFPLDKIMNIRSTHLTTLASYPDVPVRVYGVEQNFLSSVFLDFYDYTELSKSLNFPSIKGTSTPDVISSLYVNQHKQTIP
EDVGGVIVPPPSVISNGSVLYEPDNPIWWWVRNHLNNTYVYKNYTDMVISEAFRLTSGADTNTPFSLVIKYKQFEGALNV
LNLLSKPQSMVGMFPSFFFSTYSQTSWNSPVLVNIDEFYNIMNLVFSLTSDPAVQLPAVPPKSKILVKLKASATQSQRDN
VINGIRNFIKTDNIQVVDTQFLLNNTETAITILNLFFYVVSSASIILCFFMLWVSFSANIHENSWEFGVLRSIGLTSFQV
TRVYIYEALVLIFSSMILGLCIGLGIALTLTLQFDLFTELPFSFEFPYIMFIGVLISSIFIAIFVSYQSSKEYRERMIAS
VLKGK