TCDB is operated by the Saier Lab Bioinformatics Group
>KAF5349792.1 hypothetical protein D9758_010187 [Tetrapyrgos nigripes]
MYTADNRAVGWPSVFIALIFILFNALLSNAFHLGVEISLLTAAARCMVQLGIVATLLQSVLEMKNPWAVAGVILLLNLMA
AFETAMNKTKNRYSNMFPSVFICMFGSTIPISIIGVKYSMSVEPFWDPVQYIPVVGMLCGSTISGVTLSLNYILREFQEN
RDKIEMYLAFGASRSEACRPMIAEALRLALTPTINQMSVLGIISIPGMMTGAMLGGSSVQEAAKLQMIIMFMLSASTALA
SICCSAYATSILVDEEHRVRPDRIYAKFSWGEMSRVGNLIGTIRGLGIRLARKAARVTMVRRDWVELPTRRDERLLTL