TCDB is operated by the Saier Lab Bioinformatics Group
>KAG0126478.1 hypothetical protein HOY82DRAFT_593773 [Tuber indicum]
MRRHSNNVVRPTKYPSAISDSTTALQLKGLRRHFQHCLSMDYSSGFGSEPGLFGDPTEQPFAQHRPSQTQSEPSTTLIGD
DPIGSPGFATPYSPHIPQSSSDDLGHSGFASQTPITPGFQDDGGFRSPGFAGDDSPVESPKTLAHPDQQQHRQEQQQGGE
HNQRPEAQGQGSVRGQQQRQVPQYKLHAKIIALERTGRKDPILRFDVHTNLPKFRTTQFRDVRRTHPEFQKLANHLLSSN
PECFVPAVPPQSTSAGVGTDEDETRVRASMQRWLNTVCSNEVLMRDEEMVFFVESDFGYSPVIRRKQPATGVRRRVIKQF
APPPDDTPELETARPVVKAFYLGTMETGQKVDRMVRSRRGVGLAESDFGARLLAISQTEAHQGMANAFRKLGKIIQSVGD
FHAAQATSEATTLGDPLTYHSADAFIVKETLTNRQILMRELESARKDTRGKLQTMELLKGKGAIKRDKVDEALAALEEAK
SNEAHLGQKVKRVTDNLVRERRKWFARTSKDLRNSIRDYCFRQIEAERRTLATLESVRPDIRAIDQSGGLSRLGRNAPPA
SRRASIATSQGPRGDAWSGVQRVAGVKRGVEVLNGGAAITTPVPGAIKEEEEGMGDEDRLDAKNAASRLAGSTF