TCDB is operated by the Saier Lab Bioinformatics Group
>KAG2059654.1 hypothetical protein BDR06DRAFT_979790 [Suillus hirtellus]
MATLPRVIKSTLDSSIVSGNYTRPRSDAPFDAGMITSSAWTEHLECHSLSDEEPEPADEHHELQPVEEPVKAARQAESRE
LTVEAGDELNILKEEAGDGWSLVRVSSGEIGLLPQTYYTVSTDHTDRSMFVPVHGRNEPPISTITPQASFQHQSKPLSIV
PQDTGEWTNPLPSFRQSLLRGKTLNRFSGFVTSGAEEWVLEGYVDPVTPSSSSSHQRISTEDSINDDNRLSRLGLGEADR
HYVDAGPAWQSKVPKFRVLVHSPSKRTSGLSGAYTMYSVTSLFSSATDESYDPCIPPISPTRITVQRRFSHFIVLHTSLT
RRLPGIALPPLPEKQYAGRFSADFVEARRGELERYIGCIVKHPVARYAEVVTSFLGCENDADWKRIMPQLLSMPAAGPSF
FAHVFHPAFNVDLDDATEVIDRFSRHTLAVGKSTQSLRNVFGRIREVRLEMSKAERLLSYSLLSLITSTPLSSTSLGINE
DPGDAPQQRNGLLNEEGAWCWREGCQDCLKLTKAMQKTSDGLQIVADLYDDHARRTQLATHDTFKNVAHPYQLYEVSWIS
NDEMAARCETVLNTTMAEMDTYHDQKVENFSTITREYLDGEIHFYEQVLHKLKAARRTFDAPRFDELSRSPRQPSRYERD
LEAPKLNPPPLPQPCPHVYDSASTMRPVNTAIHKGIGALLGKSQPGRKGSLLGRMWAE