TCDB is operated by the Saier Lab Bioinformatics Group
>KAG2487039.1 hypothetical protein HYH03_014285 [Edaphochlamys debaryana]
MASHGTTASFDPLSADNDEAFTTVFDSASEPAQPPAATAPTAAPTAAAASEYDSFMTAQSAMSYMSQSAGGGAGAVPTAP
PAPAPAKPPTASDPFRRLPDTHAAPAAPGPTPPAPFDDLFSDPPRPSQTEAQPHTATSSSAHAAAPAVSHGGGGGGGGGG
ADLLDLGPLSFGDDAAGARGGGSGGRGGGGASAHAAFAVPMDLYDTPDYFASNHASSTAAPRGVPAAAVAAPPPPSLPPL
HDFTRELSTALPISEDPMSPTPGSFSATPLAGYASGGGAAASGGGSGTSGGGGGGAHAHHAHAPSGGGGGGAYKLFANPF
APPRASTSGAGAALPSGGGGGGGSGGAGQDSAADGDAGSSTPGGGGGGGYSAAALLTNTVSVHSPRKAVAPSRIPGLSDP
YTVFSVTSRGAGAAEATVDRRFRDVVALAEVLQALHPGCFVPPRPSRSALEARRASPAFLEERRQGIERFLCRLVVHPVL
GPSEATQVWLRLPSPDLRSAPEWQRLAPGGGPGLARSTARLLMQVVGREPTVPSPAEAVRPAAEAGDVYRLVHEKSAQLR
GVLARAQPSASEERLREEAAALAERSNGLVALGRAADHWVARGTSAGRCVGKLAEAMEALAGADEAAAEAEAAEGSGAAA
ATATAAAALRAAAEGCAKASKLYGIATDATARHLSPLHDWLAAVPGATSALAARERCLLTSATLAQDEAAARQRLAEAEA
RGVPTPAAARKLEALRQQVAGLAAAAGAAREEYERVGRRNAEELAAFKAAMSRELADAVREVALVQAAAAQKATELWRAA
AAQLSQLAAPPGSMASGAGPSGSGGGAPGAAQGQELYGGF