TCDB is operated by the Saier Lab Bioinformatics Group
>KAH3811203.1 hypothetical protein DPMN_139609 [Dreissena polymorpha]
MSSLVDVFTDKGTTNWLKAWLAVDIAKSGLDQFADNEAKNVHANIYNTVWSSGQFPAMCIGCCTANLLKCPTPGICNKRG
TNSLCQGMHDTIAKQPRPCPTNVCNKVFDEIKTLHKFSIPSWKNTSAEQWARNPWEIAKAYLPKDGYAEKSSVQDTDFNG
IISFMMNCKHFDNKFSFPIATGKHNPPCLLTKAREIGRTVRHSSQCKVTDADLQDIFTTLTNLLSDQTSLTLDVTALEAV
KKLAELQKETLKITTGEMIHLLDAANDTLKKVQNIADKSLDEMQVYLNQCKKDLKSHTDTCKHELDDHTAKCTKAIDGHA
SKAVESTYEQSCKGMHDFAFTVSCLLIAPKAYIG