TCDB is operated by the Saier Lab Bioinformatics Group
>KKK40412.1 hypothetical protein Lokiarch_51730 [Lokiarchaeum sp. GC14_75]
MASYRLIFGIIIGIVLSFLSVFFFNMESISNQIQTEPSLLRAIALLIGANFNYDIIAFFTGTPSVTGFFAAQLLAWLFIG
YVSGTIAKGLKRGITASLLVVVIDILIWIILNIIVGIDMMAFFQGNQLSETLGGLISAFIGVFIGGSVGGLISGPNEEYY