TCDB is operated by the Saier Lab Bioinformatics Group
>KKK43167.1 VIT family protein, partial [Lokiarchaeum sp. GC14_75]
RETIRKWKQYGKLSDLGEISRRKFFNNCFDGALTTAGLVSGIFMIFLAASSTIQFTPLNVLMTGFATAIAIGISGLWGAF
LSEEAERKKKVDGLKRDMAIIEDSDEKENNNGKNSKKTKTILEKAENFATIVASLVDGGAPAIGSVLPLIPFFFGVTLTI
MHFIFSYIILAALLVYLGIFLGNISGGGKLRYALHLVTAGIVTLVVTLLLSQLT