TCDB is operated by the Saier Lab Bioinformatics Group
>KKK43437.1 putative multidrug export ATP-binding/permease protein [Lokiarchaeum sp. GC14_75]
MKRKTKLSQDLTLKNISEFYLEEDDFFEARRKGVRSWLIKHIFYKSNKYYLSLFISLGILASFMNSFIYVIIGKAIESFN
TPPYLIINYTLIVFFIGITAPIAGLFGRVFREIVAQRLERDSRKEFYVNLLGKSQSFHDNQRLGDIMARATNDVRFLNFL
ISPAFAMIFFALINLIIPVVLMVFNYPVELIIIPITFSIIFILYLRRFLKKLAPPTSERRIAFGEMNTVLNESLSGIEVV
KSMAQEKQSIEKYKNSATSYRDAGIRQGDIQAKYLPILFLSFTITLGLVVSIFYVNSGAMVIGDVLGFVGLLLRLKFPVN
ASIRSFLMLQQAIIGADRLLEIMNTESEIYDTDDAISRKIEGNIKFENVTFSYPGTQNKVLKNINFEVSPGQTVAIVGST
GSGKTSLTKLISRLYEVNNGRILIDGVDVKNYSLDSLRDQIAYIEQDIFIFSDSISDNISFGRESKLEQIMEVAKEAQAH
EFILNLPQQYDTEVGERGVQLSGGERQRIAIARAFLSDPKILILDDSSSAIDSETEEKIQEAIFKILRGRTTFIITHRLS
QIRWADLIIVLDHGEIVNQGSHDYLLKNSREYQKIFIKRFDKSLNELLGGV