TCDB is operated by the Saier Lab Bioinformatics Group
>KKK45282.1 putative ABC transporter ATP-binding protein YxlF [Lokiarchaeum sp. GC14_75]
MKSLDCIEFIKVSKKFKDSLALDEISLKIQKGEIFGYIGPNGAGKTTTIKILVGLIKNYVGSVYIYGKNMSSIRKEYHQL
IGYHPQESQFQGWRTINHALKTFGRLSGLKSSFLENRITETLGLLDLLDDRHKKIIHLSGGMFQKLRLAQALLHEPEILV
LDEPLSGLDPMARFQFKKIIKKLGKRGITILFSSHILNDVQDIATKIGILNHGKILKIGTPEELQNSFKVGNVIELVVAK
NSPLCKDLETLDNVEHVENPKSNKQLIHLRSKVDVDLTISQIMNMLIEQKCRIRSFNLVKPSLEEVYLKYVGGETE