TCDB is operated by the Saier Lab Bioinformatics Group
>KKK45283.1 ABC-2 family transporter protein [Lokiarchaeum sp. GC14_75]
MSLTLLFFDELKGFAKSKVMIILWVGLPLLAFLIHFLQPDLEGFPISFLVGILISSIGGTLSSIMLSTSIVSEKNRHVYE
LFLVRPVKRGSLLLAKFLAVYLCLIIAVIISLIVGLLIDAFTIGLNENFLNSTLDSLIISISSMAITCSIGMFFGVVVSS
VPVAAILSVYLGSQLSAIIILPTFFIASLNPVTFAITLGISVTTIIMGINLFLFSRQQF