TCDB is operated by the Saier Lab Bioinformatics Group
>KKT43584.1 hypothetical protein UW32_C0001G0176 [Candidatus Wolfebacteria bacterium GW2011_GWE2_44_13]
MYSNSKINPLLLGILAAMIIHSAAVLIRELSPIQAIAPLVDVIAFHPTWAYIITILFFALINFRTIRERIICLPKQFTPR
TVETQKLILAYEAIALAFLLIIFPAIAYFYAIAHKYTAMEYPGIVRFMDYMPIADVITQTISSFPLFITFFIITSALCFS
MPHSYLTYKYEKKAPAPLHSAINFSILLSIIITLLLITLLVLNLEPWILIALIFVGPITLLAFIAINIMMLRYHDKFIKC
K