TCDB is operated by the Saier Lab Bioinformatics Group
>KKU34411.1 CmpX protein [Candidatus Wolfebacteria bacterium GW2011_GWC2_46_275]
MFVQNLTSTLYGSLANVWLGVMAFVPKFLGALIVLIIGLVIASVFGTVVEQIIKAIKLDELLKKIGVAQYVERGDMRLDS
GRFLGRAVYWFFAIVAILAVSSLLGLDVFSDFLKQVLLYFPNIVAAALIMLATLVVAKFSKSLVKASVSSAKLYAANFLG
SFVWWIVVVFGLITALMQLGINVYVLQTVITGVVAMLALAGGIAFGLGGKDYAASLIEKLKRETSEK