TCDB is operated by the Saier Lab Bioinformatics Group
>KKU98619.1 hypothetical protein UY31_C0046G0004 [Candidatus Wolfebacteria bacterium GW2011_GWE1_48_7]
MNPIDVNRNVDMIGIKGLIKIGALTFVGVLFALGFSWFFRSFLLGSEWGQLIWSMACAIGYLVVFTLQTFFIRANTHFAV
AFLLQCIALLGFFITITTPVMILFAVVYALLLSASFGGRKILENTLKIDFWNISKLIVPKGIIALTLLISVFIPLHLQAN
KDVLPLSIATFDKVLVSSNVFVKRFYQDYDPSKSVEEIARTTTEQQLAAIPQAQNLKPVEREILIKRAMNDFYEQIFSYT
GVTINPKDPFSKAAYGILEEKFNGLKDEAKLWIYIIFGSIIFISIASIMLPIRILVGLLAFFFYETLLALGFAHVTIESR
PKETIILD