TCDB is operated by the Saier Lab Bioinformatics Group
>KKW30434.1 transport protein [Parcubacteria group bacterium GW2011_GWC2_52_8c]
MFYGVLLSISAAISWGLVYVLEQKVLTEFSVAKFLIFESIFMFLVALPIALYSENPDSRFSRLDYQVVLTVPFILLMLAT
FLGNFFILSSVQQIGATVASMIEITFPLFVVIFAFYILRQPIHYLTVIGGILIMLGSALVIYVNRL