TCDB is operated by the Saier Lab Bioinformatics Group
>KOO35184.1 hypothetical protein Ctob_015248 [Chrysochromulina tobinii]
MQSSMQSSMLVWAALASTASALVVAPACPMRAAVPVAASRTAAPEMLIGRSWILAVRKTMPQFPMFRKGGSRAGGIRGAD
GGDGGMGSTAGSSDDEGDSTPMMQMWKRYEQLLEETPLLMKALTSLTGFALGDILAQKVIQKVDSFDFLRLLRLASFGFL
VHGTSSHVFYGWLDGKFPGTSAQVVFAKVLVDQVFWAPIFGMMFFSYIAAAELKGLGNVFDKMKDELVTQRVLYINTIQI
GYNCFLSLIANRGPTVAPAPVPSPARAR