TCDB is operated by the Saier Lab Bioinformatics Group
>KPL05111.1 hypothetical protein AMJ73_02380 [candidate division Zixibacteria bacterium SM1_73]
MNGLLKTAFIVCLAVFVASESLAKDGDWQLWNTESVEGNFAKNWKVKLEEEFRIGDNMEELYYHHTDGGITYKLNDLVSL
GLNYRQIFEKTKEEWKEENRPLINGTINGKWRDFVFSDRNRFEYRIRAGKQNVWRYRNKLAMTFPARWAKFDIKPYLADE
VFADLDKGEFSRNRLYAGFEAKLMKHLGADIFYLWQTSKKDKSWIDFNILGFKLKVKL