TCDB is operated by the Saier Lab Bioinformatics Group
>KQK10390.1 hypothetical protein BRADI_2g53790v3 [Brachypodium distachyon]
MMAAESSATDNYSTDGYLETLSLDSSASASTDPLLHPPPSPSSTSSPTAPANDDAFIDENGEDDFPQDLPAQDTPVISRE
PSPELYRITVSEPRKHDEPATGAAGVIPGSGSYFSYLVTTQVGDGGKFVVRRRFRDVVALADRIASTHRGLFIPPRPDKS
IVEGQVMQRHDFVNQRCAALQRYLCRLAAHPTVGRSVDLQVFLTEASGIPTSEGESPRCTPTSIAATSTAVTTPTTPAKG
GRDFFGMFKDLKQTVSNGLMAVRTLPLEEETDTKFVAHKAKLEELEQQLSTTSQQVVALVKAHEDLRETTAHLGMTFIKL
AKFEKGQSSCSSQISRAADVSNFASAVVKVSRSQTKLNAEIVKHLGTIHEYLETMSSVHNAFSDRSNALLHVQSLSSDLN
LLHNRVAKLESVSSRGIDQERSRYQKIEELKETIRATEDAKIHARKEYELIKIVMV