TCDB is operated by the Saier Lab Bioinformatics Group
>KXH73394.1 hypothetical protein AM325_07695 [Candidatus Thorarchaeota archaeon SMTZ1-45]
MNPIEIRNLVKSYGHLIAVNNLSFDVREGEIYGLLGPNGAGKTTTLKVLMGLLDPDSGTVNVFGISSVSDPIEVKKRVGY
VPEEQLLYNSLTSREILEFVASIRGLDYFHAKNRVTEMARALDFTSHYNKPIVTLSQGNKQKAMLLIAMLHAPDLLILDE
PFSGLDVRTTRIMKDVIRIHTEKGGSVLLSTHIMEMAEGLCDRVGIIDEGVLVAEGTLEELRDQAESEGATLENVFLKLT
GEEEEVREGVDALREALDN