TCDB is operated by the Saier Lab Bioinformatics Group
>KYO31156.1 small integral membrane protein 5 [Alligator mississippiensis]
MSSEGFLKEIQVIGEKFLLKLQKLPKAEPVEIATFVVILLFIVTVLSLMIIACSCCCSHCCGCNGEGPLSRSIPGLRARK
TSGQKEHPLHAEWLQGRWASMSFPRQEASQILEDLESRIQTDAWALGGLVVIGSFCTVFIVLLLFAAIFGCCSSPKRT