TCDB is operated by the Saier Lab Bioinformatics Group
>KZU99864.1 membrane protein [Lactobacillus plantarum]
MKATLQKIGTALNKRMGIIKALFVFSVLLFVITEVGKIAKEVSGAQLANALASQSWWHLLSMVVIGIIAVTPMLTYDVMI
TKFLPNHYSLGYILKAGWITNTFTNIGGFGGVLGASLRANFYNREATKKQIVFAISKIALFLVSGLSLYCMISLVLVYGF
GIGNMYGSYWIWLVGGALYFPAIFIFTRVNDSEFFDGLTLGNVVRLLSGSFGEWTGCVLFFLLIGNFMGLPIDFAAVVPL
FVIASVVGEVSMVPGGIGSFDVFMIFGLGAVGVSRPDAVAWLLFYRLFYYIIPFAIGLVLFIHDTGHRLNVRLAGIPKQA
LQRVAQMVLTVFLYFSGFLMLLMSTVPNFAYNNKLFLQFYPYTFFFINQARSIIMAFLLIGVALGTAGRVKKAFWPTVIV
LLIAILNTIRWLVVYDAISMKFVIFLIVILALVALSRHAYYRDRLAFSWGQTLWVSCVYVVTFILYTIVGVYNAPQIHHR
HAVPEALFFPSQKLWLFGVIGLVLAAMILIIMYRYFASGYNARLRQKMDAARVKQVIETYGGNEISHLAYLNDKLAYYYQ
VDGVDQLIFLYQQKADKLIIMGEPFGNQAVLQTALEQLLDDADSDGCSLVFYEISEMLTMRLHEMGFDFIKTGEEGHVKL
ADFSLAGKRLRGERALMNKFTRDHYEFAILQPPFSADVMAELRAVSDSWLAGETEKGFSLGFFDEQYLNQAPVAVVYDPD
HRIVAFANIMPQGNHQTTSIDLMRSSKSAPSGIMDTVFVHLFEQARDDGYAYFNMGMAPLSGVGVSRYSFIQEKIAHLIY
EYGYQLYGFQGLRSYKEKYVTEWEPKYIAYRKRNSLIFTILQLLQVVNTRVHKSERHRPVWLLKRLK