TCDB is operated by the Saier Lab Bioinformatics Group
>tr|L0T2W6|L0T2W6_MYCTU Mce-family protein Mce1F OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=mce1F PE=1 SV=1
MLTRFIRRQLILFAIVSVVAIVVLGWYYLRIPSLVGIGQYTLKADLPASGGLYPTANVTYRGITIGKVTAVEPTDQGARV
TMSIASNYKIPVDASANVHSVSAVGEQYIDLVSTGAPGKYFSSGQTITKGTVPSEIGPALDNSNRGLAALPTEKIGLLLD
ETAQAVGGLGPALQRLVDSTQAIVGDFKTNIGDVNDIIENSGPILDSQVNTGDQIERWARKLNNLAAQTATRDQNVRSIL
SQAAPTADEVNAVFSGVRDSLPQTLANLEVVFDMLKRYHAGVEQLLVFLPQGAAIAQTVLTPTPGAAQLPLAPAINYPPP
CLTGFLPASEWRSPADTSPRPLPSGTYCKIPQDAQLQVRGARNIPCVDVLGKRAATPKECRSKDPYVPLGTNPWFGDPNQ
ILTCPAPGARCDQPVKPGLVIPAPSINTGLNPAPADQVQGTPPPVSDPLQRPGSGTVQCNGQQPNPCVYTPTSGPSAVYS
PASGELVGPDGVKYAVANSSTTGDDGWKEMLAPAS