TCDB is operated by the Saier Lab Bioinformatics Group
>tr|L1IYV3|L1IYV3_GUITH Uncharacterized protein OS=Guillardia theta CCMP2712 GN=GUITHDRAFT_164423 PE=4 SV=1
MAPEAARKSLLRQTSMKTVLLCKKLASHAAARIIESRQDVADVRKQQLYDMWAPPKSKGDVDGDVFSRQLYARSKGIISL
LGLSKVANANSVKNEARMISGWLEVRKRGLFKVWWEMRYCELTMSGDLVVRKSQSSPVQSSTSIMDLYLVQDEKDHSVIC
LKTSEESSSDVIQMRIPSYKIRQDWVSCIRTWTKREWLEMVTQTELAVGIVLPIVGGFLNSVWNLPGNVATSDMIRVVRR
PAEESGWCWEHFWMVNQGVSIVLNLAYILPHLGVDNLHHAIVSSSSSGLAAIIVASFTWGFGTIGFGLALRLVGIGLGTA
LCMSVIVIMGVVWGFIFGGGVPTGAAGALILTGVVVAIIGFGMLGRAVHLREVGRTRRSETSGESKEHGSGQEMSCASTN
LGIDMKEVDESMKFVVVEPSSPNFPASSKSAFAAEGGGEAERRPEEPRRRTLSPLQSVGFCMVAGIFASSLQLAFVIGDS
LTQQLLALGNWAEFVRWSAAGDIIHVLRDSNRPDERLLISWRNSILSVVEDEQEKALEQKKDTNIEDKTWIAFSCHIHLY
GAAAKLLGTLGPVIAWPVLMCCTMTFGQLWGFFLREFRPDDDGRRINALGTAVLCMAIVMTSSAAAV