TCDB is operated by the Saier Lab Bioinformatics Group
>tr|L1K1F2|L1K1F2_GUITH Uncharacterized protein OS=Guillardia theta CCMP2712 GN=GUITHDRAFT_132642 PE=4 SV=1
MADGPSYFDPEQESRQKPMNGMSTYAEIAIELSDSRASAQRLREGIAMKTQTGDDAGELHVDQQVHEQAESHDETQTDHE
TLASRVRKTIQGIAAPAEILAETVMKGMSKVGHAADPLVQAVRSDLAGTDAPELTGMEICRNSKTGEFVIQQDLVENNRQ
NLSMFCSRKSLKWKGQELEDEFGISIRQYYNFLNFLTVANIALLLCSLVGWLPHALNTFPKLRDEEVIRALDGVKTLCYS
LSAMLGPAYYLIDLFYFKDASQEQYLERKIRLDDIDRKIPIEDNPDRLTKSKYMILSYFLFLLCLSVPIIVMYFILFGLN
RMMIQENYKVATNFPTNFSGTSRLLVALLAISTSSIANFIFGLVAGLLTDLELHETWTGYRNHRLAKLVVYRICNTMALL
FFTYYAEVPWYTCMITRIALQTILFVGMDLVVTLLLQMISPFVYQWWLNIINCRPCCEDQQDTREPFELTEEYFKLVFRQ
YLLYVALPLCPLFSAATLVCNVIELPLNKFRLLRLTRRPQGMQGSCKAPTGIGDTKSRWQQQAEHAAARLRPLHVEEAAM
SKLVCGRETNMSGTRCYVEEAISALCGGGACEMNVDWRLLQCSRGRYQYSYANFSKHVSTCIGGQNDAKPCKSNSYCAGG
FCDFYCPISEGSEDAYASRFHASAVPDELSMTAARAHAGSARNPWLEVL