TCDB is operated by the Saier Lab Bioinformatics Group
>tr|L7EGF5|L7EGF5_CLOPA Uncharacterized protein OS=Clostridium pasteurianum DSM 525 GN=F502_17360 PE=4 SV=1
MKNKKHMYLLINLLPVLITFYLIKFKNTFAKENWYIIVMCYSLLVFVNVMWYMQPSITYENRMKIRRTYYCISTFVLLFL
LGTVDNNIINIIGQNKLGISNNLVFTLYTFIAIILVDIFIISCKGLDEITFGATKVKFHTIEKSIETQINITETLIDKIK
SEYKAVQNIDLYISDVENDLRMAASNTSHDVDILKHLENYLEKYFCTQEKDKIHIEILALEEVQSCLSLSNSIKKYYSRY
ESIVIETRLFDENNKHYLCIPYQCTLVPDVESIIILKSDSNLILAEECIIYNLTKIFENKLLSIIDEINCTQEQ