TCDB is operated by the Saier Lab Bioinformatics Group
>tr|L8NE56|L8NE56_PSESY RND-type efflux system, outer membrane protein PseA OS=Pseudomonas syringae pv. syringae B64 GN=pseA PE=4 SV=1
MSIGKPAGYFLVSTLLVSLLSGCTLGPDYQLPAVAVASQWHAPLPHGASMVGLQDWWQQFNDPALATLLRLAQADSPSLD
QALARIAQARATLDGSVADRLPQVSGGVSKSRAGINQSGLHKSGTTSGATLDASWELDLFGKLRRTDEASRNLLEARVND
WHDARVSLAAEVGDDFVQYRGCQMLVNAYRDQAQSQEQTARLTRVSFQAGFTAAADSSLSDASAAASNATLIKQQSECDV
LLKSLVALTGSDEEQVREVLGHNPARLPQPALLDVREIPADLVRQRPDLASSERELAAANAKIGAAQADRLPKLSLVGSF
QVGTTTGVFSRVWSLGPQLTVPLFDAGKRRAAVDSAQADYDAALATYRQTLRTSVMEVEQSLVRLDAARRGQASTQQAAD
GYEASFEATDRNWQAGNASLLDREVARRSALSAQIELITVQQNQVRYWIALYKALGGGWQDSREGLARQTPKRGGA