TCDB is operated by the Saier Lab Bioinformatics Group
>tr|L8NFZ8|L8NFZ8_PSESY RND-type efflux system, inner membrane pump protein PseC OS=Pseudomonas syringae pv. syringae B64 GN=pseC PE=4 SV=1
MNISALSIRYPVPAVMLFLLLTLFGFLGLERLGIQDFPDTDLPAVVISASLEGAAPEQLETEVARKLEDKLTSLRLLKHV
TTKISEGSVLINVIFEIDKDGNEALNEVRNAVDSAAAELPANLDTPSVTRLTTNTTALLTYVVDAPRMDEEALSWFVDNE
LSKQLLTVRGVAKISRVGGVDREVQVDLDPTLMAGLGLSVTDIANRLRAMQKDNSGGQGDLGSGQQALRVLGGIDDPAAL
GAIRIPVSDGRMLAVQQLATVRDTHAERNTLAYRDGKPVIGFQVIRSLGFSDVGVTKDLRQAVSEFARQHPDVHIEEASN
AVEPVMENYRGSMALLYEGMLLAVLVVWWFLRDWRATIIVATALPLSIIPTFGVMYFAGFSLNTVSLLALALVIGILVDD
AIVEVENIARHLRMGKTPRQAAIEASDEIGLAVLATTVTLVAVFLPTAFMGGISGKLFRQFGVTASAALMFSLLVARLLT
PMMAAYLLKARPHGEHDSGLMRRYLGWIHTSLSRRKTTMAIVGALFIGSLALIPLLPTSFLPAQDIASSTVSLELPPGTS
LAQTGEIALQAEKRLRAIPEVAHVFIAAGSGDAGGAGDRDAKLTVDLLPRDQRTLKQSQVEASMRESLRSLPGVRVTVGG
DGSGERLDIVLASDDGDLLERTAAALEPQLRQIKGIGNVTSSAAVQRPEIQMRPDVFRAAEQGISSQDIADTLRMATYGE
YSSSLGKINLSQRQVNVRVRMQPQVRTDLQSLAQLRIKGRDGQIALASLGELSMGSGPAEIDRIDRLRNITLSIELNGSN
LGEVMEQARQLPAMQNLPAQVKLVEQGELQLMSELFGNFSLAMAVGVFCIYAVLVLLFHDFMQPLTILSALPLSLGGALL
ALLIGGMSFSMASVIGLLMLMGIVTKNSILLVEYAIMARRAPTVSRYEALIDACHKRARPILMTTIAMGAGMLPTALGWG
GESGFRQPMAVVVIGGLLASTVLSLLVVPVIFTYVDDGHETFKRWFSRPRQTHD