TCDB is operated by the Saier Lab Bioinformatics Group
>tr|L8NGR5|L8NGR5_PSESY RND-type efflux system, membrane fusion protein (MFP) subunit PseB OS=Pseudomonas syringae pv. syringae B64 GN=pseB PE=4 SV=1
MRKIHVYGLLALAALSVSGWILFGRAEPTPAAVAAPATSLTVEAVQPHREDWPQELVASGALAPWQEAVISAETGSLRIA
SLKADIGDQVKKGQVLATLADDSVLAEENKQKSAVAQATAQLQEARSNARRAAVVGQSGALSEQQLEEYRVKVQTAEANL
ASANADLRSIRIKLKQTRIVAVDDGIISGRKALLGDVVSAGSEMFRMIRDGRIEWQAELDAQQLPGVKPGQLARVMLPGG
IEVQGRVRLVSPVLDGKTSRALVYVSLPVGAVARAGMYASGRIELPSSPALTVPDTSVILRDGHSYVFVLGKDMRVSQHV
VEIGRRRGSALEIVGGLAEQAQIVCSGGAFLNDGASVTLVNAEARAQ