TCDB is operated by the Saier Lab Bioinformatics Group
>tr|L9ZDR4|L9ZDR4_9EURY Uncharacterized protein OS=Natrinema altunense JCM 12890 GN=C485_14720 PE=4 SV=1
MPEKSGDGADNGGGTDADAGTGPDVEGGPRAASDAGTSVDPSVLHLSPAEREARGITDDEVREAFRAVLVRGTEAQKDLS
GVTLPDLSLDRIALESVDRHPVDLSGATIEGLSLTHARVTLPFVLDGATIGSLRLTEAHVEASISCSNATVTGETDLFEA
RFDDDVTFDGATFEGPVDCDEATFRDDVRFDGTTFDDEVTFRAAECHGDSNHLEDNTTFSGATFRASVTFRETEFGFSMF
DGITCDEAAVFQEATFTGDAEFRGAEFGADADFDEVRFEGDTAFTDAAFRGAATFRGGSFEGGARTLVDDATFAGTTFHD
DVSFHRASFRYVTFAGAAFRGEAHFESATFDGDADFPDVTFAREVDFDETRFREDADFSGVAFDSRCVFRGCEFTGGANH
LKDDVSFEDARFADDVDFHDAEISSANFRATAFGGTVDFSRCVVSERIDLEARGIDDDAFVDFTRGKIRSGRIVQPAEGW
VRYDLTLASIGDVDLAAERTRDHRQLLDYFRFCRTEFDEFDGHTFDFSGHREYLDRNDWTVHAFDEPSTDTFDPDYALAM
TPEVVETTYLKAKQSASEIGDMKTAGEFRVKRQRYSRRKSLEAARDPDAGVVTRAKNLGRAAENCFLGLTCGHGMRPMRI
GTAFAIAPLFFAFPYTFGGPLFETQASGFYENLYFSYISYTTIGYGNIGPVGPLARFLAGSEAYLSTILAALLVYALVKR
SEL