TCDB is operated by the Saier Lab Bioinformatics Group
>tr|M0BSL0|M0BSL0_9EURY Major facilitator superfamily protein OS=Haloterrigena salina JCM 13891 GN=C477_23120 PE=4 SV=1
MALRETVDRLRGYDVLVLTATIWFLAKFLRYAFPPLFDSFGASYGVSNAVLGTAYTGLMLVYAAMQFPSGVLADRFGSVG
VITAGVVVAAVAALALVVDSPFLVLVGAMLVMGAGTGAHKTVAVRLLSRAYPARTGRALGVLDTFGAFGGVVAPAVIVAV
ASVSFPLGDSWRLLFLGAGLVGLALGAAFRVRVPQRLPDDSAGDAATAAVSAGGIGQYTTLLRDPRFAVFALLTVLFSFT
YNGFVAFAPLYLTQEAGLTDATASLLYSALFLASLVQLVTGDLSDRVGRLPLIVGTLGIASVALTALIALTGTAGPPVLG
VALVAVGIGSHGFRPVRGAYLMSAIPDDVAGGGLGVVRTLLMAAGAIAPAIVGTLSEVAGFRPAFALLAASVAAATALGA
VLWLLE