TCDB is operated by the Saier Lab Bioinformatics Group
>tr|M0HK80|M0HK80_9EURY Uncharacterized protein OS=Haloferax gibbonsii ATCC 33959 GN=C454_02670 PE=4 SV=1
MDGGISLGLPAATPEAVAFLLVGLFGGAHCLGMCGPLVSVYADRLADREGVDRRSLTVRQVRQHALFNVGRALSYAAIGA
VFALVGGLFFDAFDSVAAVGSGVRATTGLLVGGAIILTGVGYLVGQSAAIDRFTPTAVTRLFGRVSGWATARVDRLVGGP
RILGLGAIHGLLPCPIIYPAYLYAFSTGEPLRAAALLGLLGLGTIPTLFLYGTLLGRVSARRRATLHRALGAAFLVLGYI
PLSHGLMLLGVSVPHLHVPFYQPL