TCDB is operated by the Saier Lab Bioinformatics Group
>tr|M1V7G4|M1V7G4_CYAME Uncharacterized protein OS=Cyanidioschyzon merolae strain 10D GN=CYME_CMT050C PE=4 SV=1
MFLEAELTWALGDLPLCAAAGAPRSTLALRRCAVPLTVLEAGRRFRRPTRTGFWVRKIRSQNQSDPQQEQDRILVSRKQQ
PSRQPHVNKPAAADTTGSTGAVTVLPGLQVPGRALYYFIAFLWGSFSPAVRELYTLKHPPPPALFNTARLLLSSATFWPV
WRTQWLVLQQRLRRARTNSTPVDDDYGNADGADMTAANGYGGEGGRLGAQLSPRELASTLTALFWSDTYRWFRGGLELGL
YVFLGNVAQVIGLEYTPAARAAFLVQLQTVFIPLLSDFFARIGFLEPGSSQLNSQTLITSGMAFLGVFLLSQDKTSTVPS
NWLGDSLEVLAAFTFSVYVLRLDRYARAITDTTPLAATKILVQTVCSLGWAVFSSQSNGHVHAGAELPPLSWYDALVTVG
VVAWTGLLVSAFSAYVQPQCQKRVSASETGVILATQPLFAAALSVLFLGERLGWKGALGGLVILLSTVVSSFLNAPQQPR
SKLQKHDADSKTNS